perfectkitchenchinesetakeaway.co.uk - Perfect Kitchen

Description: Perfect Kitchen, Takeaway, Restaurant, Yummy, Tasty, Chinese Food

restaurant (28105) takeaway (2813) chinese food (1158) tasty (207) yummy (124) perfect kitchen (2)

Example domain paragraphs

Scroll for more

The Perfect Kitchen takeaway has long and well established over 30 years (Since 1980) the current business operated by Head Chef SU, he having worked many places as China, Dubai, Welsh, England ( including Hotel Du Vin) The menu are true oriental flavours such are Chinese, Thailand, Singapore, Malaysia... cuisine, our food are fresh prepared daily and cooking with vegetable oil. Why wait, come and enjoy the cooking experiences... PERFECT KITCHEN, PERFECT CHOICE !

Promotion: 10% OFF for orders over £15. Orders over £10 free prawn crackers, or over £40 free bottle of coke & prawn crackers