steadmanhawkinsclinicdenverfellowship.org - UCHealth Steadman Hawkins Clinic Denver | Sports Medicine Englewood

Description: UCHealth Steadman Hawkins Clinic Denver in Englewood, CO provides an educational experience that focuses on management of non-operative and operative athletic disorders.

sports medicine (995) uchealth steadman hawkins clinic denver (2)

Example domain paragraphs

This fellowship is an ACGME-accredited program that uses a mentorship approach to provide an educational experience that focuses on management of non-operative and operative athletic disorders. It is our goal to ultimately produce excellent, independent orthopedic sports medicine physicians.

This fellowship focuses on the operative and non-operative care of athletic disorders. Educational emphasis is placed on both open and arthroscopic surgical techniques, as well as postoperative rehabilitation.

www.tomnoonanmd.com

Links to steadmanhawkinsclinicdenverfellowship.org (1)