williamsfieldveterinaryservice.com - Welcome to Wags and Whiskers Veterinary Service

Description: Wags and Whiskers Veterinary Service is proud to serve the companion animals in Western Peoria County and the surrounding region.

Example domain paragraphs

Give Us a Call!

Welcome to

Wags and Whiskers Veterinary Service is proud to serve the companion animals in Western Peoria County and the surrounding region. Our veterinary clinics are ran by Dr. Janelle McFarland. Dr. McFarland is a licensed, experienced veterinarian was born and raised in this area.